PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Aradu.D0JN5
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Dalbergieae; Arachis
Family MYB
Protein Properties Length: 371aa    MW: 41374.1 Da    PI: 6.8354
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Aradu.D0JN5genomeNCGR_PGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding64.91.5e-201663148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WT+eEde+l+d++k++G g+W+t +++ g++R++k+c++rw +yl
      Aradu.D0JN5 16 KGPWTPEEDEKLIDYIKKHGHGSWRTLSKRAGLNRCGKSCRLRWANYL 63
                     79********************************************97 PP

2Myb_DNA-binding574.5e-1869113147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg++T++E+ ++v+++ +lG++ W++Ia++++ gRt++++k++w+++
      Aradu.D0JN5  69 RGKFTPDEERIIVNLHSLLGNK-WSKIASHLP-GRTDNEIKNFWNTH 113
                      89********************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129419.2431163IPR017930Myb domain
SuperFamilySSF466898.61E-3313110IPR009057Homeodomain-like
SMARTSM007176.8E-171565IPR001005SANT/Myb domain
PfamPF002491.3E-181663IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-251770IPR009057Homeodomain-like
CDDcd001678.52E-141863No hitNo description
PROSITE profilePS5129427.97464118IPR017930Myb domain
SMARTSM007173.8E-1768116IPR001005SANT/Myb domain
PfamPF002492.0E-1669113IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.605.7E-2771118IPR009057Homeodomain-like
CDDcd001674.23E-1371114No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 371 aa     Download sequence    Send to blast
MGRSPCCDES SGNVKKGPWT PEEDEKLIDY IKKHGHGSWR TLSKRAGLNR CGKSCRLRWA  60
NYLRPDIKRG KFTPDEERII VNLHSLLGNK WSKIASHLPG RTDNEIKNFW NTHIRKKLLQ  120
MGIDPDTHKP RTDFNHLINL THLLAAAMSS NSGNPMMNMN TPTWGRNPNI ALQGDVTSQL  180
SQLHLLQNLL QIMNSNTFVN LGNNPNFPLG NPSFNNSYLN GSNILQTVEP FAGLKSEEYG  240
SQSNPTTGLL SQSDYSSDFF QHGLSTNTQE LECYNKLSNT TNQAEINPLF PALVASSPVI  300
TDGTCSSFNQ MENKNSSCCN TAPTSTAQSP NNNSNTIFDD LEKLLQDDET SASYWKDILD  360
LTSICASENS W
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-31161187108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00438DAPTransfer from AT4G17785Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015963118.10.0PREDICTED: transcription factor MYB39-like
TrEMBLI1L4Y61e-138I1L4Y6_SOYBN; Uncharacterized protein
STRINGGLYMA09G33870.11e-138(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF40234172
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G02940.18e-80myb domain protein 107